PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011845-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family SRS
Protein Properties Length: 313aa    MW: 33808.5 Da    PI: 8.167
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011845-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.23.7e-71952412153
         DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                    +sg++sCqdCGnqakkdC+h+RCRtCCksrgf+C thvkstWvpa++rrerqq+laa+++++ ++ + +++kr+re+   ++ +l++t+l++++s 
  NNU_011845-RA  95 GSGSMSCQDCGNQAKKDCSHMRCRTCCKSRGFQCPTHVKSTWVPASRRRERQQHLAALQQQQ-QQLRGENPKRQREN--PSAPSLACTRLPTTTSG 187
                    5799****************************************************997766.55778888999987..77889999999999765 PP

         DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                      le+ ++P+ev+s+avfrcvrvs+ d++++++aYqtav+igGhvfkGiLydqG+e
  NNU_011845-RA 188 --LEVGNFPAEVNSPAVFRCVRVSAFDEADDQYAYQTAVNIGGHVFKGILYDQGPE 241
                    ..89999***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.1E-6798241IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27100142IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.7E-27193240IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAGFSLSGGG GGAAAANQRQ QHHQNNEIPP ESLFLYRNEE ISYNKGFELW QQHLHQRQTH  60
QEIYPSSLAV GPSRETNIAD ELSSRAAIVT MRQGGSGSMS CQDCGNQAKK DCSHMRCRTC  120
CKSRGFQCPT HVKSTWVPAS RRRERQQHLA ALQQQQQQLR GENPKRQREN PSAPSLACTR  180
LPTTTSGLEV GNFPAEVNSP AVFRCVRVSA FDEADDQYAY QTAVNIGGHV FKGILYDQGP  240
EGHYVPGESS SGGGGVPLNL ITAGTATTTT TTNVTTTTAA ASAAAALLDP TSLYPTPINA  300
FMAGTQFFPH PRS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263848.10.0PREDICTED: protein SHI RELATED SEQUENCE 1 isoform X1
SwissprotQ9XGX07e-96SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A061DFV61e-132A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGVIT_04s0023g02780.t011e-114(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-72Lateral root primordium (LRP) protein-related